PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G060109_P01
Common NamebZIP91, si606053d09
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family bZIP
Protein Properties Length: 563aa    MW: 59819.5 Da    PI: 5.3998
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G060109_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_144.63.2e-14114176163
                        XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
             bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                        e e kr  r  +NRe+A  sRqRKk+++eeLe kvk+++a   +L  +++  + e a+lk+++
  GRMZM2G060109_P01 114 EDEAKRRARQVRNRESAHLSRQRKKQYVEELEGKVKAMQATIADLSARISCVTAENAALKQQL 176
                        5789********************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.8E-12113178IPR004827Basic-leucine zipper domain
PfamPF001701.2E-12114176IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.277116176IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.8E-16118176No hitNo description
SuperFamilySSF579598.13E-13118176No hitNo description
CDDcd147045.81E-20119170No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016021Cellular Componentintegral component of membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 563 aa     Download sequence    Send to blast
MAEPALLPPD PFADLPFPEF QAPIDGDSFA LEDFDLEDLD LDVDFDLDLF GSDGQPSQPP  60
PLATSSSSAG SPVGGSSSSG AVGDGGGLRN EESSESSSRS ASGTDGSGKG KGEEDEAKRR  120
ARQVRNRESA HLSRQRKKQY VEELEGKVKA MQATIADLSA RISCVTAENA ALKQQLGGAA  180
GAAPPPMPMY PTMYSLPMPW MHPSYPMRGS QVPLVPIPRL KPPQPASAVA EPPAKKARKT  240
KKVASVSLLG LICVAMLCGC LIPAVNRMYD SVDAGEGAAY GPSHRGRVLA VEGPHDNVSD  300
GVDPKPPQRA SETLPALLYL PKNGKHVKIN GNLVIKSIVA SEKASLQMSG NDGKRPQNQE  360
EETRLAIPGY VTPLKAGEVM ESTEGMMNNE LLALAPADGS MYREEDGLLP QWFSEAMSGP  420
LLSSGMCTEV FQFDVSPSSA HPNGIIPVYS NAMSNSSQNF TQDLPPARVR TVKNRRISYS  480
EAIPLRGSTS NDTEHLKSFG STKPVSSVVV SVLADPREAG DGDGEGRISS KSLSRILVVV  540
LIDSVKYVTY SCVLPFKSHS PHL
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.850830.0ear| embryo| endosperm| leaf| meristem| ovary| shoot
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G060109
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G060109_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0400110.0BT040011.1 Zea mays full-length cDNA clone ZM_BFc0058K20 mRNA, complete cds.
GenBankBT0612020.0BT061202.1 Zea mays full-length cDNA clone ZM_BFb0122E10 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001152144.10.0uncharacterized protein LOC100285782
TrEMBLB4FSC30.0B4FSC3_MAIZE; BZIP transcription factor
STRINGGRMZM2G060109_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP111793035
Representative plantOGRP21711628
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.19e-73bZIP family protein